0

Tesamorelin 20mg

Synthetic 44-amino-acid GHRH analog. Lipodystrophy and metabolic research compound.

From $281.99

- +

SKU: TESA-2701-A

  • Free shipping over $200
  • Interac + BTC
  • Same-day Canadian dispatch
  • Discreet packaging

Additional information

Pack Size

Single Vial, 10-Pack

Janoshik testedVerifiable COA per batch
≥99% pureHPLC + MS verified
Ships from CanadaTracked Xpresspost

Tesamorelin is a 44-residue synthetic peptide modelled on the full-length human growth hormone-releasing hormone, GHRH(1-44). What distinguishes the molecule from native GHRH is a single chemical modification on the N-terminus: a trans-3-hexenoic acid acyl group attached to the first residue, tyrosine. The hexenoyl modification blocks the dipeptidyl peptidase IV cleavage site that ordinarily clips native GHRH's first two residues within minutes of release. With that cleavage site protected, the peptide survives long enough in plasma to reach pituitary somatotrophs and engage the GHRH receptor.

Studied in research literature

VAT reduction (HIV lipodystrophy)

Visceral adipose tissue reduction across Phase 2 + 3 clinical trials in HIV-associated lipodystrophy populations.

Liver fat (NAFLD)

Hepatic steatosis reduction and liver enzyme improvement in HIV-associated NAFLD research.

Cognition + adipose quality

Recent research extends to neurocognitive outcomes and adipose tissue quality independent of fat quantity.

Quality verification

Independent third-party HPLC + MS testing per batch

Batch
TESA-2701-A
Lab
Janoshik Analytical
HPLC purity
99.4%
MS identity
confirmed
Tested
2026-04-12
Email for COA

COAs are not posted publicly. Email support@roninpeptides.ca from the address used at checkout, with your order number; reply within 24 hours.

Storage and handling

LyophilizedSealed amber vial
−20 °C unmixed2+ year stability
2–8 °C reconstitutedStable 2–3 weeks
Avoid lightProtect from heat

Tesamorelin (a synthetic growth hormone-releasing hormone analog) is a 44-amino-acid peptide carrying an N-terminal trans-3-hexenoyl modification that confers resistance to dipeptidyl peptidase IV cleavage. Research has examined the compound primarily in models of HIV-associated visceral adiposity, with secondary investigation into NAFLD, metabolic-profile outcomes, and neurocognitive endpoints. Each batch carries a Janoshik Analytical Certificate of Analysis covering HPLC purity quantification and MS identity confirmation. The minimum-acceptance threshold is 99 percent purity by HPLC. Supplied as a lyophilized powder in a sealed glass vial, 20 mg per vial. Research-grade laboratory compound; human and veterinary use are excluded.

Description

Tesamorelin is a 44-residue synthetic peptide modelled on the full-length human growth hormone-releasing hormone, GHRH(1-44). What distinguishes the molecule from native GHRH is a single chemical modification on the N-terminus: a trans-3-hexenoic acid acyl group attached to the first residue, tyrosine. The hexenoyl modification blocks the dipeptidyl peptidase IV cleavage site that ordinarily clips native GHRH's first two residues within minutes of release. With that cleavage site protected, the peptide survives long enough in plasma to reach pituitary somatotrophs and engage the GHRH receptor.

The compound was developed by Theratechnologies, a Quebec-based clinical-stage pharmaceutical company, originally under the research designation TH9507. Initial regulatory approval for the branded pharmaceutical formulation came in 2010 for HIV-associated lipodystrophy, specifically reduction of excess visceral adiposity in adult patients with the condition. Ronin Peptides supplies tesamorelin as a research-grade lyophilized peptide for laboratory use only; it is not the approved pharmaceutical formulation, and Ronin makes no representation that the two are interchangeable.

Across the published literature the compound has been documented in HIV-related research streams (Falutz et al. Phase 2 in NEJM 2007 and Phase 3 in JCEM 2010), in NAFLD studies extending the lipodystrophy findings to liver-fat outcomes (Fourman et al. 2017, 2020), and more recently in trials examining neurocognitive endpoints in HIV populations with abdominal obesity (Ellis et al. 2025). A 2024 RCT confirmed that the visceral-adipose-tissue findings observed in earlier trials hold up under contemporary HIV regimens (Russo et al. 2024).

The molecule's central pharmacological output is pulsatile growth hormone release. Because it works upstream at the GHRH receptor rather than supplying GH directly, the response preserves the physiologic pulsatile GH pattern. Endogenous GH then drives a downstream rise in IGF-1, which in turn supports lipolysis preferentially in visceral adipose tissue.

Tesamorelin is supplied as a lyophilized white powder in a sealed amber-glass vial under inert gas, at 20 mg per vial. Reconstitution with bacteriostatic water is required before the peptide can be drawn into an injection syringe; see the Reconstitution accordion for the dilution math.

Mechanism in research literature

Investigators have characterised the receptor-level mechanism in detail and have studied it across multiple model systems. The compound binds the growth hormone-releasing hormone receptor (GHRHR), a Gαs-coupled G-protein-coupled receptor expressed on pituitary somatotroph cells. Studies have documented that receptor engagement raises intracellular cyclic AMP, which activates protein kinase A and triggers GH secretion (PMID 19243281). Because the compound preserves the pulsatile pattern of endogenous GHRH signalling, the resulting GH release retains the natural cadence rather than the flat profile that follows direct exogenous GH administration. Researchers have observed this preserved pulsatility across the published clinical-research record.

The pharmacokinetic feature that distinguishes tesamorelin from native GHRH is the N-terminal trans-3-hexenoyl modification. Native GHRH(1-44) is rapidly cleaved by DPP-IV between Ala-2 and Asp-3, giving a plasma half-life of roughly seven minutes. The acyl modification physically obstructs that cleavage. Plasma half-life after subcutaneous administration in clinical research is approximately 26 minutes, which gives enough exposure for the pituitary GHRH receptor to be engaged while keeping the GH pulse brief and mirroring physiologic release (PMID 17086939, PMID 19243281).

Downstream, the GH pulse drives hepatic IGF-1 production through STAT5 signalling. Elevated IGF-1 then participates in the lipolytic and metabolic outcomes documented in clinical research. Falutz et al. reported sustained IGF-1 elevation across the Phase 3 program with a return to baseline after dosing concluded (PMID 20554713). Stanley et al. tied the visceral-adiposity reduction in those same trials to changes in inflammatory markers. Investigators reported that CRP and IL-6 trended downward, while adiponectin trended upward, in a pattern correlated with the magnitude of VAT reduction (PMID 21516030, PMID 22495074).

Hepatic effects of the compound extend beyond circulating IGF-1. Fourman et al. characterised hepatic transcriptomic responses in NAFLD using RNA-seq and identified shifts in lipid-metabolism gene programs after the compound was administered (PMID 32701508). The Lake 2021 finding that adipose-tissue quality changes independently of total adipose mass suggests researchers have not reduced the mechanism to simple lipolysis (PMID 33756511). Investigators continue to examine these secondary pathways.

Studied properties

The largest published research stream for tesamorelin is reduction of visceral adipose tissue (VAT) in HIV-associated lipodystrophy. The Falutz Phase 2 trial randomised approximately 412 HIV-positive adults with excess abdominal fat to tesamorelin 2 mg/day subcutaneous or placebo for 26 weeks; the primary endpoint was percent change in VAT measured by computed tomography (PMID 18057338). The treatment group showed an approximate 15% VAT reduction versus placebo, with subcutaneous fat largely preserved.

Two parallel pivotal Phase 3 trials extended the Phase 2 findings under controlled conditions across multi-centre populations, with the pooled analysis published in 2010 (PMID 20554713). Each trial used a 26-week double-blind tesamorelin-versus-placebo phase followed by a safety-extension period. The pooled VAT reduction across Phase 3 was 15–18%; the long-term extension showed durability over an additional six months of continued dosing (PMID 18690162, PMID 20101189). Continued treatment was required to maintain the VAT response; cessation produced a partial return toward baseline.

Secondary outcomes from the Phase 3 program included improvements in metabolic markers correlated with VAT reduction. Triglycerides decreased; HDL cholesterol increased modestly; fasting glucose was unchanged at the population level (PMID 22495074). Inflammatory markers tracked the VAT response, with CRP and IL-6 falling and adiponectin rising in patients with substantial VAT loss (PMID 21516030).

Liver-fat research extends the visceral-adipose findings into NAFLD. Fourman et al. observed reduction of hepatic steatosis and improvement in liver enzymes (ALT, AST) in HIV-associated NAFLD treated with tesamorelin (PMID 28832410). The 2020 hepatic-transcriptomics analysis identified gene-expression changes consistent with reduced hepatic lipogenesis and altered fatty-acid handling (PMID 32701508).

More recent research has examined neurocognitive outcomes. The Ellis 2025 Phase 2 RCT enrolled HIV-positive adults with abdominal obesity and assessed cognitive performance after twelve months of treatment, finding mixed but mechanistically plausible signals on attention and processing-speed metrics (PMID 39813152). The Russo 2024 trial confirmed VAT reduction in HIV patients on integrase-strand-transfer-inhibitor regimens. That confirmation matters because the original Phase 3 program predated widespread integrase-inhibitor use (PMID 38905488). Together these papers extend the tesamorelin literature past the original lipodystrophy framing into modern HIV care and into outcomes beyond fat distribution alone.

A 2021 finding from Lake et al. complicates the simple "VAT reduction" story: investigators reported that the compound appears to improve adipose tissue quality, including measures of fibrosis and adipocyte morphology, somewhat independently of changes in fat quantity (PMID 33756511). Studies of this kind point to a substantive mechanistic nuance for researchers planning new work.

Compound specifications
Specification Value
Common name Tesamorelin
Schema alternate name Tesamorelin Acetate (chemical-variant designation)
Research designation TH9507 (original development)
Class Synthetic 44-amino-acid GHRH analog
Modification N-terminal trans-3-hexenoyl acyl group on Tyr-1
Function of modification Resistance to dipeptidyl peptidase IV (DPP-IV) cleavage
Molecular formula C221H366N72O67S
Molecular weight 5135.85 g/mol (free peptide); ~5197 g/mol (acetate salt, single counterion)
CAS number 218949-48-5 (free); 901758-09-6 (acetate)
PubChem CID 16137828
Sequence (1-letter) YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (with N-trans-3-hexenoyl + C-terminal amide)
Length 44 amino acids
Form Lyophilized white-to-off-white powder
Solubility Bacteriostatic water; sterile water for injection
Plasma half-life (subcutaneous, clinical research) ~26 minutes
Receptor target GHRH receptor (GHRHR) — Gαs-coupled GPCR on pituitary somatotrophs
Vial contents 20 mg peptide, sealed amber-glass vial under inert gas
Purity ≥99% by HPLC (verified per batch by Janoshik Analytical)
Storage and handling

Researchers have observed that tesamorelin is less stable at ambient temperature than smaller peptides like BPC-157 or TB-500. Sealed lyophilized vials are best held under refrigeration at 2–8 °C from receipt onward — short ambient excursions during shipping of one to three days are tolerated, but sustained ambient storage of more than a few days is not recommended for this compound. Long-term archival storage of unopened lyophilized vials uses −20 °C in a standard freezer.

Keep vials shielded from light, ideally in their original outer packaging. The acyl modification on the N-terminus introduces an additional oxidation-sensitive site beyond the standard peptide-bond hydrolysis pathways, so light protection matters more here than for unmodified peptide compounds.

After reconstitution, refrigerate the solution at 2–8 °C without delay. Investigators have measured working potency for a reconstituted preparation at typically two to three weeks under refrigeration — meaningfully shorter than for many smaller peptides because the larger, more conformationally complex molecule has more degradation-susceptible regions (PMID 33756511). Visible discolouration, cloudiness, or precipitate indicates the solution should be discarded.

When a research timeline extends past the working window, common practice is splitting the reconstituted solution into single-use volumes immediately after reconstitution — freezing those aliquots at −20 °C — to limit cumulative damage. Researchers have documented that each freeze-thaw cycle damages peptide chains, and pre-splitting eliminates the cumulative loss that comes from thawing one bulk vial multiple times. Thaw individual aliquots overnight in a refrigerator and use within a few days of thaw.

The reconstitution diluent is USP-grade bacteriostatic water containing 0.9% benzyl alcohol; see the bacteriostatic water product page for reconstitution-grade water.

Compare with similar compounds
Compound Class Documented mechanism Format at Ronin
Tesamorelin GHRH(1-44) analog with N-terminal trans-3-hexenoyl modification GHRHR activation → pulsatile GH release → IGF-1 elevation → VAT-preferential lipolysis 10 mg vial
CJC-1295 (no DAC) GHRH(1-29) analog with four amino-acid substitutions for DPP-IV resistance GHRHR activation; shorter peptide and shorter half-life than tesamorelin (~30 min) 10 mg vial
Sermorelin GHRH(1-29), unmodified — first 29 residues of native human GHRH GHRHR activation; rapid DPP-IV cleavage gives very short half-life (~10–15 min) (Not in Ronin launch catalog)
Ipamorelin Pentapeptide ghrelin mimetic GH secretagogue receptor (GHSR) activation — engages a different receptor than GHRH analogs; often paired with a GHRH analog in research protocols 10 mg vial

The tesamorelin design retains the full 44-residue GHRH sequence; CJC-1295 retains the 29-residue truncated form. Both compounds achieve DPP-IV resistance through different chemistry — tesamorelin via N-acyl modification, CJC-1295 via substitutions at positions susceptible to enzymatic clipping. Sermorelin lacks any DPP-IV-resistance modification and clears more rapidly. Ipamorelin acts on a separate receptor (GHSR rather than GHRHR), which is why researchers studying the GH axis frequently administer a GHRH analog and a ghrelin mimetic together — see the CJC-1295 + Ipamorelin blend for a combined-compound research format.

Reconstitution and laboratory handling

A 20 mg tesamorelin vial reconstituted with 2 mL of bacteriostatic water yields a working concentration of 10 mg/mL. Alternative dilutions: 1 mL gives 20 mg/mL (concentrated stock); 5 mL gives 4 mg/mL (dilute stock).

Reconstitution procedure — six steps, in order:

  1. Bring both vials — peptide and bacteriostatic water — to room temperature before opening.
  2. Sanitise both rubber stoppers with an alcohol swab.
  3. Pull the chosen diluent volume into a sterile transfer syringe.
  4. Direct the water against the inner wall of the peptide vial as it is injected — never onto the lyophilized cake, since direct impact foams the solution and damages peptide structure at the air-water interface.
  5. Invert slowly or swirl gently until everything dissolves. Do not vortex; do not shake. Tesamorelin is a larger peptide and may take 60–90 seconds to dissolve fully — longer than smaller compounds.
  6. Refrigerate at 2–8 °C the moment reconstitution completes — no delay.

A finished preparation should be visually transparent with no suspended particulate. Discard if hazy.

For concentration math across different reconstitution volumes, the Ronin peptide reconstitution calculator has tesamorelin pre-loaded as a preset.

Frequently asked questions
What is Tesamorelin?

Tesamorelin is a 44-amino-acid synthetic analog of human growth hormone-releasing hormone (GHRH(1-44)), modified with a trans-3-hexenoyl acyl group on the N-terminal tyrosine to resist dipeptidyl peptidase IV cleavage. It binds the pituitary GHRH receptor and stimulates pulsatile growth hormone release, which in turn raises IGF-1 and supports preferential reduction of visceral adipose tissue. Ronin Peptides offers tesamorelin as a research-grade laboratory reagent; it is sold for bench use only and is not intended for human or veterinary administration.

How does Tesamorelin differ from native GHRH and from earlier GHRH analogs?

Native GHRH(1-44) is rapidly cleaved by dipeptidyl peptidase IV between residues two and three, giving a plasma half-life of about seven minutes. Tesamorelin's N-terminal acyl modification physically blocks that cleavage, extending half-life to about 26 minutes — long enough for the peptide to engage the pituitary GHRH receptor at meaningful exposure. Sermorelin (GHRH(1-29)) has no DPP-IV-resistance modification and clears even faster; CJC-1295 (no DAC) is GHRH(1-29) with amino-acid substitutions for DPP-IV resistance. Ronin's tesamorelin compound page covers the comparison in the Compare with similar compounds accordion.

What is the regulatory status of Tesamorelin?

Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH) studied for its effects on visceral adipose tissue, metabolic markers, and lipodystrophy-associated body composition changes. The compound has been the subject of multiple peer-reviewed clinical investigations in adults with HIV-associated metabolic conditions.

Tesamorelin is not listed as a scheduled controlled substance under the international drug-control conventions or under the major national scheduling systems. It sits within the regulatory layer covering laboratory reagents and research chemicals, not the layer governing human therapeutics.

Ronin Peptides supplies the compound as a research-grade reagent for laboratory and bench-research applications. Buyers operate under their own jurisdictional laws and any applicable institutional review protocols when handling the compound — Ronin Peptides assumes no oversight of downstream lab practice.

How is Tesamorelin verified?

Each batch passes through Janoshik Analytical, an independent peptide-analytics lab, for HPLC purity quantification and MS identity confirmation, with the minimum acceptance threshold set at 99 percent purity by HPLC. Every Janoshik COA includes a verification key that resolves at janoshik.com, so researchers can confirm the certificate's authenticity without trusting the manufacturer's word alone. To pull the COA covering the batch on your order, email support@roninpeptides.ca with your order number; the typical reply turnaround is well under 24 hours.

What is the difference between Tesamorelin and CJC-1295?

Both compounds are GHRH-receptor agonists that achieve DPP-IV resistance, but through different chemistry and on different peptide backbones. Tesamorelin is the full 44-residue GHRH sequence with an N-terminal trans-3-hexenoyl acyl modification; CJC-1295 is the truncated 29-residue GHRH(1-29) sequence with four amino-acid substitutions at protease-susceptible positions. Plasma half-life is similar in scale (under an hour for both), and both produce pulsatile GH release. The choice between them in a research protocol typically depends on the cited prior literature being modelled — tesamorelin has the larger HIV-lipodystrophy clinical-trial literature, CJC-1295 the larger non-HIV GH-axis preclinical literature.

How is Tesamorelin reconstituted?

The standard preparation is 2 mL of bacteriostatic water added to a 20 mg vial, producing a 10 mg/mL solution. Inject the water against the inside wall of the vial — never directly onto the lyophilized powder, which causes foaming and surface denaturation. Swirl gently or invert slowly until fully dissolved (60–90 seconds for tesamorelin, longer than smaller peptides). Refrigerate at 2–8 °C immediately after reconstitution. Use the Ronin reconstitution calculator for concentration math across different reconstitution volumes.

How do I receive the COA for my batch?

Email support@roninpeptides.ca from the email address used at checkout, with your order number (e.g., RP-CA-1234) and the compound name. We reply within 24 hours — typically the same business day — with the COA PDF attached. The COA includes the Janoshik verification key, which you can check independently at janoshik.com to confirm the test results match what the laboratory ran on your specific batch.

References
  1. Tomlinson B. Drug evaluation: tesamorelin, a synthetic human growth hormone releasing factor. Curr Opin Investig Drugs. 2006;7(10):936-945. PMID: 17086939
  2. Wang Y et al. Tesamorelin, a human growth hormone releasing factor analogue. Expert Opin Investig Drugs. 2009;18(3):303-310. PMID: 19243281 | doi:10.1517/13543780802707658
  3. Falutz J et al. Metabolic effects of a growth hormone-releasing factor in patients with HIV. N Engl J Med. 2007;357(23):2359-2370. PMID: 18057338 | doi:10.1056/NEJMoa072375
  4. Falutz J et al. Long-term safety and effects of tesamorelin, a growth hormone-releasing factor analogue, in HIV patients with abdominal fat accumulation. AIDS. 2008;22(14):1719-1728. PMID: 18690162 | doi:10.1097/QAD.0b013e32830a5058
  5. Falutz J et al. Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. J Acquir Immune Defic Syndr. 2010;53(3):311-322. PMID: 20101189 | doi:10.1097/QAI.0b013e3181cbdaff
  6. Falutz J et al. Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in human immunodeficiency virus-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials with safety extension data. J Clin Endocrinol Metab. 2010;95(9):4291-4304. PMID: 20554713 | doi:10.1210/jc.2010-0490
  7. Stanley TL et al. Effects of tesamorelin on inflammatory markers in HIV patients with excess abdominal fat: relationship with visceral adipose reduction. AIDS. 2011;25(10):1281-1288. PMID: 21516030 | doi:10.1097/QAD.0b013e328347f3f1
  8. Spooner LM et al. Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy. Ann Pharmacother. 2012;46(2):240-247. PMID: 22298602 | doi:10.1345/aph.1Q629
  9. Stanley TL et al. Reduction in visceral adiposity is associated with an improved metabolic profile in HIV-infected patients receiving tesamorelin. Clin Infect Dis. 2012;54(11):1642-1651. PMID: 22495074 | doi:10.1093/cid/cis251
  10. Fourman LT et al. Visceral fat reduction with tesamorelin is associated with improved liver enzymes in HIV. AIDS. 2017;31(16):2253-2259. PMID: 28832410 | doi:10.1097/QAD.0000000000001614
  11. Fourman LT et al. Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD. JCI Insight. 2020;5(16):e140134. PMID: 32701508 | doi:10.1172/jci.insight.140134
  12. Lake JE et al. Tesamorelin improves fat quality independent of changes in fat quantity. AIDS. 2021;35(9):1395-1402. PMID: 33756511 | doi:10.1097/QAD.0000000000002897
  13. Russo SC et al. Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors. AIDS. 2024;38(12):1758-1764. PMID: 38905488 | doi:10.1097/QAD.0000000000003965
  14. Ellis RJ et al. Effects of Tesamorelin on Neurocognitive Impairment in Persons With HIV and Abdominal Obesity. J Infect Dis. 2025;231(5):1230-1238. PMID: 39813152 | doi:10.1093/infdis/jiaf012

Other compounds in our catalog

Shopping Cart
Scroll to Top